PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G259700.1
Common NameB456_006G259700, LOC105800716
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 673aa    MW: 74145.5 Da    PI: 6.4247
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G259700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.19.8e-29214267155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv av+qL G+ekA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Gorai.006G259700.1 214 KPRVVWSVELHQQFVAAVNQL-GIEKAVPKKILELMNVPGLTRENVASHLQKYRL 267
                         79*******************.********************************8 PP

2Response_reg78.23e-26361441109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+vdD+p+ +++l+++l+  +y +v+ +  +e al +l+e++  +D+++ D+ mp+mdG++ll++i  e  +lp+i+++a + ++ + + 
  Gorai.006G259700.1  36 VLLVDDDPTCLMILEKMLKACQY-NVTKCNRAETALSMLRENRngFDIVISDVHMPDMDGFKLLEHIGLEM-DLPVIMMSADDGKNVVMKG 124
                         89*********************.***************99999***********************6654.8****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga d+l Kp+ +e+l +
  Gorai.006G259700.1 125 VTHGACDYLIKPVRIEALKN 144
                         ****************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363924.0E-17910663IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.3E-4233176No hitNo description
SuperFamilySSF521725.98E-3633157IPR011006CheY-like superfamily
SMARTSM004483.9E-3034146IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.93135150IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.5E-2336144IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.71E-2637149No hitNo description
SuperFamilySSF466897.53E-20211271IPR009057Homeodomain-like
PROSITE profilePS5129410.62211270IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-30213272IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-24214267IPR006447Myb domain, plants
PfamPF002491.6E-7216266IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0010082Biological Processregulation of root meristem growth
GO:0010119Biological Processregulation of stomatal movement
GO:0010150Biological Processleaf senescence
GO:0071368Biological Processcellular response to cytokinin stimulus
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 673 aa     Download sequence    Send to blast
MNSSSGKSYM STASSSVLWK AGGDVVADQF PAGLRVLLVD DDPTCLMILE KMLKACQYNV  60
TKCNRAETAL SMLRENRNGF DIVISDVHMP DMDGFKLLEH IGLEMDLPVI MMSADDGKNV  120
VMKGVTHGAC DYLIKPVRIE ALKNIWQHVV RKRKNEWKDF EQSGSVEEGD RQPKQSEDAD  180
YSSSANEGNW KSSKRRKDDE DENDERDDTS TLKKPRVVWS VELHQQFVAA VNQLGIEKAV  240
PKKILELMNV PGLTRENVAS HLQKYRLYLR RLSGVSQHPS NLNNSFMNPQ DATFGPLDLQ  300
ALAATGQLPA QSLATLQAAG LGRSTAKSGI PMPLIDQRNI FSFENPKLRF GEAQQQHVNN  360
NKQTNLLHGI PTTMEPKQLA GLHHTAQSMG NMNMPVLSHG SQSSQNNPLL MQMAQPQARG  420
QMLNDSTVGL APRLLSPRGQ SMLSNGMATN VSTRNGVPEN IRAPSYNPVS QTSSMFNFPM  480
NHTSELPGNS FPLVSTPGIS SLAPKVAFQE DVNSEIKGSV GFMPSYDIFN DLNQHKPQNW  540
ELQNVGMMFN SSRPSNSLQG NLDHTQSILV QQGFLSGQNR NSTVISKAMF SAGDSTGHVN  600
AQNSNQHLNS LLDNTVRVKF ERVADAAPAN LYPDHFGQED LMSALLKQQD IIAPAENNDF  660
DFDGYSIDNI PV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-22213273464ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00054PBMTransfer from AT4G16110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012487455.10.0PREDICTED: two-component response regulator ARR2-like isoform X1
SwissprotQ9ZWJ90.0ARR2_ARATH; Two-component response regulator ARR2
TrEMBLA0A0D2T4M50.0A0A0D2T4M5_G
STRINGGLYMA07G37220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24032773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.20.0response regulator 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]